- SLC26A10 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92400
- Unconjugated
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- SLC26A10
- This antibody was developed against Recombinant Protein corresponding to amino acids: FGTRGQFRCN LEWHLGLGEG EKETSKPDGP MVAVAEPVRV VVLDFSGVTF ADAAGAREVV Q
- solute carrier family 26 member 10, pseudogene
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- SLC26A10
- Immunogen affinity purified
Sequence
FGTRGQFRCNLEWHLGLGEGEKETSKPDGPMVAVAEPVRVVVLDFSGVTFADAAGAREVVQ
Specifications/Features
Available conjugates: Unconjugated